PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA31G00535
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 323aa    MW: 36424.6 Da    PI: 4.9781
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA31G00535genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.86.1e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++lvd+v+++G g W+t + + g++R++k+c++rw +yl
       AA31G00535 14 KGAWTPEEDKKLVDYVNRHGEGGWRTLPDKAGLKRCGKSCRLRWANYL 61
                     79********************************************97 PP

2Myb_DNA-binding55.31.6e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg +T++E++ ++++++ +G++ W++Iar++  gRt++++k++w+++
       AA31G00535  67 RGEFTQDEEDSIIKLHAIHGNK-WSAIARRLS-GRTDNEIKNHWNTH 111
                      899*******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.9E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.466961IPR017930Myb domain
SuperFamilySSF466891.14E-2911108IPR009057Homeodomain-like
SMARTSM007172.7E-131363IPR001005SANT/Myb domain
PfamPF002491.2E-161461IPR001005SANT/Myb domain
CDDcd001673.58E-101661No hitNo description
PROSITE profilePS5129425.98862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2565117IPR009057Homeodomain-like
SMARTSM007174.4E-1666114IPR001005SANT/Myb domain
PfamPF002492.4E-1567111IPR001005SANT/Myb domain
CDDcd001671.15E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009625Biological Processresponse to insect
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MVRTPCCRAE GLKKGAWTPE EDKKLVDYVN RHGEGGWRTL PDKAGLKRCG KSCRLRWANY  60
LRPDIKRGEF TQDEEDSIIK LHAIHGNKWS AIARRLSGRT DNEIKNHWNT HIKKRLIKKG  120
IDPSTHEPLS GDTDKSDTPE KSDIQENDDQ KLENKKSLRS SSSAKFLNRV ANKFGQKINL  180
SVMSEIIGSG GPLTSHTSSV TTPLECCELS EKSTTPMSSS TFTSNDPFIY SDIVGDIDGF  240
TSKFLSDVVV SRDDEEDLTM LDDESCVFMK ELTMILQEDN NSQSNTMSFE DDIDFNMINE  300
VVDHCGSFGE VDNYFSDYIN LVN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013652391.11e-129PREDICTED: transcription factor MYB122-like
SwissprotQ9C9C81e-122MY122_ARATH; Transcription factor MYB122
TrEMBLA0A078E5I91e-131A0A078E5I9_BRANA; BnaA07g31220D protein
STRINGBra015939.1-P1e-129(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74080.11e-116myb domain protein 122